>
产品中心 >
Functional_antibody >
avivasysbio/DDX11 Antibody - N-terminal region (ARP81919_P050)/100 ul/ARP81919_P050

Predicted Species Reactivity | Human |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human DDX11 |
Purification | Affinity purified |
Peptide Sequence | Synthetic peptide located within the following region: LGRCVVMVGMPFPNIRSAELQEKMAYLDQTLSPRPGTPREGSGGEPVHEG |
Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
Blocking Peptide | For anti-DDX11 (ARP81919_P050) antibody is Catalog # AAP81919 |
Datasheets/Manuals | Printable datasheet for anti-DDX11 (ARP81919_P050) antibody |
Gene Symbol | DDX11 |
---|---|
Official Gene Full Name | DEAD/H-box helicase 11 |
Alias Symbols | CHL1, KRG2, WABS, CHLR1 |
NCBI Gene Id | 1663 |
Protein Name | ATP-dependent DNA helicase DDX11 |
Description of Target | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is an enzyme that possesses both ATPase and DNA helicase activities. This gene is a homolog of the yeast CHL1 gene, and may function to maintain chromosome transmission fidelity and genome stability. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Swissprot Id | Q96FC9 |
Protein Accession # | NP_001244073.1 |
Nucleotide Accession # | NM_001257144.2 |
Protein Size (# AA) | 970 |
Molecular Weight | 106 kDa |
Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express DDX11. ![]() |
RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express DDX11. ![]() |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
What is the species homology for "DDX11 Antibody - N-terminal region (ARP81919_P050)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".
How long will it take to receive "DDX11 Antibody - N-terminal region (ARP81919_P050)"?
This item is available "Domestic: within 24 hours delivery | International: 3-5 days".
What buffer format is "DDX11 Antibody - N-terminal region (ARP81919_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "DDX11 Antibody - N-terminal region (ARP81919_P050)"?
This target may also be called "CHL1, KRG2, WABS, CHLR1" in publications.
What is the shipping cost for "DDX11 Antibody - N-terminal region (ARP81919_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "DDX11 Antibody - N-terminal region (ARP81919_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "DDX11 Antibody - N-terminal region (ARP81919_P050)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "106 kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "DDX11 Antibody - N-terminal region (ARP81919_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "DDX11"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "DDX11"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "DDX11"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "DDX11"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "DDX11"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "DDX11"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.