>
产品中心 >
Anti_Human >
avivasysbio/PRKCB Antibody - C-terminal region (ARP97839_P050)/100 ul/ARP97839_P050

Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PRKCB1 |
Purification | Affinity purified |
Peptide Sequence | Synthetic peptide located within the following region: KPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEF |
Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
Blocking Peptide | For anti-PRKCB (ARP97839_P050) antibody is Catalog # AAP97839 |
Datasheets/Manuals | Printable datasheet for anti-PRKCB (ARP97839_P050) antibody |
Gene Symbol | PRKCB |
---|---|
Official Gene Full Name | protein kinase C beta |
Alias Symbols | PKCB, PRKCB1, PRKCB2, PKCI(2), PKCbeta, PKC-beta |
NCBI Gene Id | 5579 |
Protein Name | protein kinase C beta type |
Description of Target | Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This protein kinase has been reported to be involved in many different cellular functions, such as B cell activation, apoptosis induction, endothelial cell proliferation, and intestinal sugar absorption. Studies in mice also suggest that this kinase may also regulate neuronal functions and correlate fear-induced conflict behavior after stress. Alternatively spliced transcript variants encoding distinct isoforms have been reported. |
Swissprot Id | P05771 |
Protein Accession # | NP_002729.2 |
Nucleotide Accession # | NM_002738.6 |
Protein Size (# AA) | 671 |
Molecular Weight | 73 kDa |
Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express PRKCB. ![]() |
RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express PRKCB. ![]() |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
What is the species homology for "PRKCB Antibody - C-terminal region (ARP97839_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".
How long will it take to receive "PRKCB Antibody - C-terminal region (ARP97839_P050)"?
This item is available "Domestic: within 24 hours delivery | International: 3-5 days".
What buffer format is "PRKCB Antibody - C-terminal region (ARP97839_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "PRKCB Antibody - C-terminal region (ARP97839_P050)"?
This target may also be called "PKCB, PRKCB1, PRKCB2, PKCI(2), PKCbeta, PKC-beta" in publications.
What is the shipping cost for "PRKCB Antibody - C-terminal region (ARP97839_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "PRKCB Antibody - C-terminal region (ARP97839_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "PRKCB Antibody - C-terminal region (ARP97839_P050)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "73 kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "PRKCB Antibody - C-terminal region (ARP97839_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "PRKCB"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "PRKCB"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "PRKCB"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "PRKCB"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "PRKCB"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "PRKCB"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.