| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Guinea Pig, Human, Mouse, Rat |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Replacement Item | This antibody may replace item sc-166754 from Santa Cruz Biotechnology. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ADRM1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rat: 86% |
| Complete computational species homology data | Anti-ADRM1 (ARP59363_P050) |
| Peptide Sequence | Synthetic peptide located within the following region: QLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDE |
| Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
| Blocking Peptide | For anti-ADRM1 (ARP59363_P050) antibody is Catalog # AAP59363 (Previous Catalog # AAPP45459) |
| Datasheets/Manuals | Printable datasheet for anti-ADRM1 (ARP59363_P050) antibody |
| Sample Type Confirmation | ADRM1 is supported by BioGPS gene expression data to be expressed in 721_B, HeLa |
| Gene Symbol | ADRM1 |
|---|---|
| Official Gene Full Name | Adhesion regulating molecule 1 |
| Alias Symbols | ARM1, GP110, MGC29536, Rpn13 |
| NCBI Gene Id | 11047 |
| Protein Name | Proteasomal ubiquitin receptor ADRM1 |
| Description of Target | The protein encoded by this gene is an integral plasma membrane protein which promotes cell adhesion. The encoded protein is thought to undergo O-linked glycosylation. Expression of this gene has been shown to be induced by gamma interferon in some cancer cells. Two transcript variants encoding the same protein have been found for this gene. |
| Swissprot Id | Q16186 |
| Protein Accession # | NP_783163 |
| Nucleotide Accession # | NM_175573 |
| Protein Size (# AA) | 407 |
| Molecular Weight | 40kDa |
| Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express ADRM1.  |
| RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express ADRM1.  |
| Protein Interactions | UCHL5; HUWE1; UBC; PSMD14; SHFM1; PSME1; PSMD4; PSMA1; PPP1R2P4; TXNL1; PSMC1; RPS21; RPS8; PSMD13; PSMD11; PSMD8; PSMD7; PSMD3; PSMD2; PSMD1; PSMC6; PSMC5; PSMC4; PSMC3; PSMC2; PARK2; APP; UBD; UBQLN1; RAD23; DSK2; RAD23B; PSMA2; ATP6V0D2; FKBP8; RAD23A; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
- Reviewed Data:
- Product Protocols: ADRM1 antibody tested with Human Placenta Tissue (ARP59363_P050)
What is the species homology for "ADRM1 Antibody - C-terminal region (ARP59363_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Guinea Pig, Human, Mouse, Rat".
How long will it take to receive "ADRM1 Antibody - C-terminal region (ARP59363_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
What buffer format is "ADRM1 Antibody - C-terminal region (ARP59363_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "ADRM1 Antibody - C-terminal region (ARP59363_P050)"?
This target may also be called "ARM1, GP110, MGC29536, Rpn13" in publications.
What is the shipping cost for "ADRM1 Antibody - C-terminal region (ARP59363_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "ADRM1 Antibody - C-terminal region (ARP59363_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "ADRM1 Antibody - C-terminal region (ARP59363_P050)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "40kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "ADRM1 Antibody - C-terminal region (ARP59363_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "ADRM1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "ADRM1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "ADRM1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "ADRM1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "ADRM1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "ADRM1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
