
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Cow, Guinea Pig, Human |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB, FC |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Replacement Item | This antibody may replace item sc-1780 from Santa Cruz Biotechnology. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CASP5 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 83%; Guinea Pig: 82%; Human: 100% |
Complete computational species homology data | Anti-CASP5 (ARP58992_P050) |
Peptide Sequence | Synthetic peptide located within the following region: VIIVQACRGEKHGELWVRDSPASLALISSQSSENLEADSVCKIHEEKDFI |
Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
Blocking Peptide | For anti-CASP5 (ARP58992_P050) antibody is Catalog # AAP58992 (Previous Catalog # AAPP44959) |
Datasheets/Manuals | Printable datasheet for anti-CASP5 (ARP58992_P050) antibody |
Gene Symbol | CASP5 |
---|---|
Official Gene Full Name | Caspase 5, apoptosis-related cysteine peptidase |
Alias Symbols | ICE(rel)III, ICEREL-III, ICH-3, MGC141966 |
NCBI Gene Id | 838 |
Protein Name | Caspase-5 |
Description of Target | This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. Overexpression of the active form of this enzyme induces apoptosis in fibroblasts. Max, a central component of the Myc/Max/Mad transcription regulation network important for cell growth, differentiation, and apoptosis, is cleaved by this protein; this process requires Fas-mediated dephosphorylation of Max. The expression of this gene is regulated by interferon-gamma and lipopolysaccharide. Alternatively spliced transcript variants have been identified for this gene. |
Swissprot Id | P51878 |
Protein Accession # | NP_001129581 |
Nucleotide Accession # | NM_001136109 |
Protein Size (# AA) | 376 |
Molecular Weight | 43kDa |
Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express CASP5. ![]() |
RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express CASP5. ![]() |
Protein Interactions | PPHLN1; NLRP1; CASP5; MAX; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
- Reviewed Data:
- Product Protocols: CASP5 antibody tested with Human A549 Cells (ARP58992_P050)
What is the species homology for "CASP5 Antibody - middle region (ARP58992_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Guinea Pig, Human".
How long will it take to receive "CASP5 Antibody - middle region (ARP58992_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
What buffer format is "CASP5 Antibody - middle region (ARP58992_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "CASP5 Antibody - middle region (ARP58992_P050)"?
This target may also be called "ICE(rel)III, ICEREL-III, ICH-3, MGC141966" in publications.
What is the shipping cost for "CASP5 Antibody - middle region (ARP58992_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "CASP5 Antibody - middle region (ARP58992_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "CASP5 Antibody - middle region (ARP58992_P050)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "43kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "CASP5 Antibody - middle region (ARP58992_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "CASP5"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "CASP5"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "CASP5"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "CASP5"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "CASP5"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "CASP5"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.