
Tested Species Reactivity | Human, Mouse |
---|---|
Predicted Species Reactivity | Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, IF, WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Replacement Item | This antibody may replace item sc-113594 from Santa Cruz Biotechnology. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human IGF1R |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rat: 92%; Sheep: 100%; Zebrafish: 100% |
Complete computational species homology data | Anti-IGF1R (AVARP00004_P050) |
Peptide Sequence | Synthetic peptide located within the following region: DRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC |
Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
Blocking Peptide | For anti-IGF1R (AVARP00004_P050) antibody is Catalog # AAP30448 (Previous Catalog # AAPP01032) |
Datasheets/Manuals | Printable datasheet for anti-IGF1R (AVARP00004_P050) antibody |
Specificity | Directed to the beta chain of IGF1R |
Target Reference | Urano,T., (2008) Spine 33 (11), 1256-1261 |
Publications | Kubota, T. et al. Insulin-like growth factor-1 receptor in mature osteoblasts is required for periosteal bone formation induced by reloading. Acta Astronaut. 92, 73-78 (2013). IHC, IF, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish 23976802 |
Gene Symbol | IGF1R |
---|---|
Official Gene Full Name | Insulin-like growth factor 1 receptor |
Alias Symbols | CD221, IGFIR, JTK13, MGC142170, MGC142172, MGC18216, IGFR |
NCBI Gene Id | 3480 |
Protein Name | Insulin-like growth factor 1 receptor |
Description of Target | This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival.This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-140 DR007209.1 566-705 141-3559 X04434.1 136-3554 3560-4540 BC113610.1 3542-4522 4541-4921 DA486252.1 187-567 4922-5392 BX093045.1 248-718 5393-5768 CN414655.1 317-692 5769-6158 BM264223.1 185-574 6159-6580 BQ185364.1 187-608 6581-11242 AC069029.9 21278-25939 c |
Swissprot Id | P08069 |
Protein Accession # | NP_000866 |
Nucleotide Accession # | NM_000875 |
Protein Size (# AA) | 1367 |
Molecular Weight | 71kDa |
Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express IGF1R. ![]() |
RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express IGF1R. ![]() |
Protein Interactions | KCNIP3; UBC; ESR1; PHB2; SHC1; FBXO6; SH2B1; Slc23a3; RPL11; HSP90AA1; GRB14; FFAR2; ARRB2; AMY2A; APP; RUVBL1; GNB2L1; ARRB1; YWHAG; TP53; NEDD4; MDM2; GRB10; SUMO1; CAMP; ERBB2; EGFR; KRT27; DOK5; DOK4; WISP2; EHD1; ARHGEF12; PIK3R3; VAV3; PRKD1; SOCS2; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
- Reviewed Data:
- Product Protocols: IGF1R antibody tested with Human Jurkat Cells (AVARP00004_P050)
- Product Review: IGF1R antibody - middle region (AVARP00004_P050) using Immunofluorescence (IF)
What is the species homology for "IGF1R Antibody - middle region (AVARP00004_P050)"?
The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish".
How long will it take to receive "IGF1R Antibody - middle region (AVARP00004_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
What buffer format is "IGF1R Antibody - middle region (AVARP00004_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "IGF1R Antibody - middle region (AVARP00004_P050)"?
This target may also be called "CD221, IGFIR, JTK13, MGC142170, MGC142172, MGC18216, IGFR" in publications.
What is the shipping cost for "IGF1R Antibody - middle region (AVARP00004_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "IGF1R Antibody - middle region (AVARP00004_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "IGF1R Antibody - middle region (AVARP00004_P050)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "71kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "IGF1R Antibody - middle region (AVARP00004_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "IGF1R"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "IGF1R"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "IGF1R"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "IGF1R"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "IGF1R"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "IGF1R"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.