
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Replacement Item | This antibody may replace item sc-292307 from Santa Cruz Biotechnology. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human GAS7 |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86% |
Complete computational species homology data | Anti-GAS7 (ARP47759_T100) |
Peptide Sequence | Synthetic peptide located within the following region: IRQHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGN |
Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
Blocking Peptide | For anti-GAS7 (ARP47759_T100) antibody is Catalog # AAP47759 (Previous Catalog # AAPS22511) |
Datasheets/Manuals | Printable datasheet for anti-GAS7 (ARP47759_T100) antibody |
Target Reference | Chao,C.C., (2005) J. Neurosci. Res. 81 (2), 153-162 |
Gene Symbol | GAS7 |
---|---|
Official Gene Full Name | Growth arrest-specific 7 |
Alias Symbols | KIAA0394, MGC1348, MLL/GAS7 |
NCBI Gene Id | 8522 |
Protein Name | Growth arrest-specific protein 7 |
Description of Target | The growth arrest-specific 7 (GAS7) gene is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development.Growth arrest-specific 7 is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development. Several transcript variants encoding proteins which vary in the N-terminus have been described. |
Swissprot Id | Q7Z571 |
Protein Accession # | NP_958839 |
Nucleotide Accession # | NM_201433 |
Protein Size (# AA) | 476 |
Molecular Weight | 54kDa |
Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express GAS7. ![]() |
RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express GAS7. ![]() |
Protein Interactions | WDYHV1; GAS7; APBB1IP; CYFIP2; CYFIP1; NCKAP1; KHDRBS1; SF3A1; WASF2; ABI1; SF1; WAS; SFPQ; RPLP0; HNRNPU; NCKAP1L; GAPDH; DIAPH1; FMNL1; CREB3L2; ATXN1L; PACSIN1; ACTA1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
- Reviewed Data:
- Product Protocols: GAS7 antibody tested with Human Hepg2 Cells (ARP47759_T100)
What is the species homology for "GAS7 Antibody - C-terminal region (ARP47759_T100)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".
How long will it take to receive "GAS7 Antibody - C-terminal region (ARP47759_T100)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
What buffer format is "GAS7 Antibody - C-terminal region (ARP47759_T100)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "GAS7 Antibody - C-terminal region (ARP47759_T100)"?
This target may also be called "KIAA0394, MGC1348, MLL/GAS7" in publications.
What is the shipping cost for "GAS7 Antibody - C-terminal region (ARP47759_T100)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "GAS7 Antibody - C-terminal region (ARP47759_T100)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "GAS7 Antibody - C-terminal region (ARP47759_T100)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "54kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "GAS7 Antibody - C-terminal region (ARP47759_T100)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "GAS7"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "GAS7"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "GAS7"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "GAS7"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "GAS7"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "GAS7"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.