
Tested Species Reactivity | Human, Rat |
---|---|
Predicted Species Reactivity | Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Additional Information | IHC Information: Paraffin embedded brain, cortex tissue, tested with an antibody dilution of 5 ug/ml. |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Replacement Item | This antibody may replace item sc-135892 from Santa Cruz Biotechnology. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC1A2 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 92% |
Complete computational species homology data | Anti-SLC1A2 (ARP33840_P050) |
Peptide Sequence | Synthetic peptide located within the following region: PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTK |
Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
Blocking Peptide | For anti-SLC1A2 (ARP33840_P050) antibody is Catalog # AAP33840 (Previous Catalog # AAPP04911) |
Datasheets/Manuals | Printable datasheet for anti-SLC1A2 (ARP33840_P050) antibody |
Target Reference | Uhl,G.R., (2008) Arch. Gen. Psychiatry 65 (6), 683-693 |
Publications | Pretto, D. I. et al. Reduced excitatory amino acid transporter 1 and metabotropic glutamate receptor 5 expression in the cerebellum of fragile X mental retardation gene 1 premutation carriers with fragile X-associated tremor/ataxia syndrome. Neurobiol. Aging 35, 1189-97 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 24332449 |
Gene Symbol | SLC1A2 |
---|---|
Official Gene Full Name | Solute carrier family 1 (glial high affinity glutamate transporter), member 2 |
Alias Symbols | EAAT2, GLT-1 |
NCBI Gene Id | 6506 |
Protein Name | Excitatory amino acid transporter 2 |
Description of Target | SLC1A2 is a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Swissprot Id | P43004 |
Protein Accession # | NP_004162 |
Nucleotide Accession # | NM_004171 |
Protein Size (# AA) | 574 |
Molecular Weight | 62kDa |
Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express SLC1A2. ![]() |
RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express SLC1A2. ![]() |
Protein Interactions | PML; GRB2; AJUBA; SLC1A2; MYCN; RELA; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
- Reviewed Data:
- Product Protocols: SLC1A2 antibody tested with Human Fetal Brain Tissue (ARP33840_P050)
What is the species homology for "SLC1A2 Antibody - N-terminal region (ARP33840_P050)"?
The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish".
How long will it take to receive "SLC1A2 Antibody - N-terminal region (ARP33840_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
What buffer format is "SLC1A2 Antibody - N-terminal region (ARP33840_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "SLC1A2 Antibody - N-terminal region (ARP33840_P050)"?
This target may also be called "EAAT2, GLT-1" in publications.
What is the shipping cost for "SLC1A2 Antibody - N-terminal region (ARP33840_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "SLC1A2 Antibody - N-terminal region (ARP33840_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "SLC1A2 Antibody - N-terminal region (ARP33840_P050)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "62kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "SLC1A2 Antibody - N-terminal region (ARP33840_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "SLC1A2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "SLC1A2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "SLC1A2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "SLC1A2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "SLC1A2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "SLC1A2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.