
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Replacement Item | This antibody may replace item sc-20728 from Santa Cruz Biotechnology. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PTHLH |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100% |
Complete computational species homology data | Anti-PTHLH (ARP33885_T100) |
Peptide Sequence | Synthetic peptide located within the following region: YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS |
Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
Blocking Peptide | For anti-PTHLH (ARP33885_T100) antibody is Catalog # AAP33885 (Previous Catalog # AAPP04956) |
Datasheets/Manuals | Printable datasheet for anti-PTHLH (ARP33885_T100) antibody |
Target Reference | Chen,C., et al., (2004) J. Biol. Chem. 279 (28), 29121-29129 |
Publications | Müller, M., Gagiannis, S., Nawroth, P. P., Brune, M. & Schilling, T. Activation of the receptor for parathyroid hormone and parathyroid hormone related protein induces apoptosis via the extrinsic and intrinsic signaling pathway. Int. J. Mol. Med. 24, 373-80 (2009). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19639230 Zhao, C.-M. et al. Gene expression profiling of gastric mucosa in mice lacking CCK and gastrin receptors. Regul. Pept. 192-193C, 35-44 (2014). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 25160855 |
Gene Symbol | PTHLH |
---|---|
Official Gene Full Name | Parathyroid hormone-like hormone |
Alias Symbols | HHM, PLP, BDE2, PTHR, PTHRP |
NCBI Gene Id | 5744 |
Protein Name | Parathyroid hormone-related protein |
Description of Target | PTHLH is a member of the parathyroid hormone family. This hormone regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. This hormone is involved in lactation possibly by regulating the mobilization and transfer of calcium to the milk. The receptor of this hormone, PTHR1, is responsible for most cases of humoral hypercalcemia of malignancy. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed. |
Swissprot Id | P12272 |
Protein Accession # | NP_002811 |
Nucleotide Accession # | NM_002820 |
Protein Size (# AA) | 175 |
Molecular Weight | 20kDa |
Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express PTHLH. ![]() |
RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express PTHLH. ![]() |
Protein Interactions | ELAVL1; PLK1; KPNB1; KLK3; PTH1R; IL6; CDK2; ARRB1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
- Reviewed Data:
- Product Protocols: PTHLH antibody tested with Human Hepg2 Cells (ARP33885_T100)
- Product Protocols: PTHLH antibody tested by IHC with human lung (ARP33885)
- Product Protocols: PTHLH antibody tested by IHC with human kidney (ARP33885)
What is the species homology for "PTHLH Antibody - middle region (ARP33885_T100)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".
How long will it take to receive "PTHLH Antibody - middle region (ARP33885_T100)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
What buffer format is "PTHLH Antibody - middle region (ARP33885_T100)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "PTHLH Antibody - middle region (ARP33885_T100)"?
This target may also be called "HHM, PLP, BDE2, PTHR, PTHRP" in publications.
What is the shipping cost for "PTHLH Antibody - middle region (ARP33885_T100)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "PTHLH Antibody - middle region (ARP33885_T100)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "PTHLH Antibody - middle region (ARP33885_T100)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "20kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "PTHLH Antibody - middle region (ARP33885_T100)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "PTHLH"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "PTHLH"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "PTHLH"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "PTHLH"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "PTHLH"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "PTHLH"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.