| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Replacement Item | This antibody may replace item sc-25140 from Santa Cruz Biotechnology. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SMARCE1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Complete computational species homology data | Anti-SMARCE1 (ARP38224_P050) |
| Peptide Sequence | Synthetic peptide located within the following region: MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSR |
| Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
| Blocking Peptide | For anti-SMARCE1 (ARP38224_P050) antibody is Catalog # AAPS05009 |
| Datasheets/Manuals | Printable datasheet for anti-SMARCE1 (ARP38224_P050) antibody |
| Sample Type Confirmation | SMARCE1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
| Target Reference | Chen,J. (2005) Mol. Cell. Biol. 25 (20), 9016-9027 |
| Gene Symbol | SMARCE1 |
|---|---|
| Official Gene Full Name | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 |
| Alias Symbols | BAF57 |
| NCBI Gene Id | 6605 |
| Protein Name | SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 |
| Description of Target | SMARCE1 is part of the large ATP-dependent chromatin remodeling complex SWI/SNF, which is required for transcriptional activation of genes normally repressed by chromatin. The protein, either alone or when in the SWI/SNF complex, can bind to 4-way junction DNA, which is thought to mimic the topology of DNA as it enters or exits the nucleosome. The protein contains a DNA-binding HMG domain, but disruption of this domain does not abolish the DNA-binding or nucleosome-displacement activities of the SWI/SNF complex. Unlike most of the SWI/SNF complex proteins, this protein has no yeast counterpart.The protein encoded by this gene is part of the large ATP-dependent chromatin remodeling complex SWI/SNF, which is required for transcriptional activation of genes normally repressed by chromatin. The encoded protein, either alone or when in the SWI/SNF complex, can bind to 4-way junction DNA, which is thought to mimic the topology of DNA as it enters or exits the nucleosome. The protein contains a DNA-binding HMG domain, but disruption of this domain does not abolish the DNA-binding or nucleosome-displacement activities of the SWI/SNF complex. Unlike most of the SWI/SNF complex proteins, this protein has no yeast counterpart. |
| Swissprot Id | Q969G3 |
| Protein Accession # | NP_003070 |
| Nucleotide Accession # | NM_003079 |
| Protein Size (# AA) | 411 |
| Molecular Weight | 47kDa |
| Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express SMARCE1.  |
| RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express SMARCE1.  |
| Protein Interactions | NOTCH2NL; KRTAP10-9; CCDC172; NBPF22P; TXLNA; MIPOL1; KRT40; MRFAP1L1; SYCE1; ING5; USHBP1; CEP70; CEP63; CCDC136; RINT1; TRIM54; AMOTL2; MED4; TFIP11; NUP62; MTUS2; EXOC7; RALBP1; SPAG5; JAKMIP2; TRIP10; STX11; CEP170P1; MEOX2; KRT31; KRT15; KIFC3; GOLGA |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
- Reviewed Data:
- Product Protocols: SMARCE1 antibody tested with Human Jurkat Cells (ARP38224_P050)
- Product Protocols: SMARCE1 antibody tested by IHC with human kidney (ARP38224)
- Product Protocols: SMARCE1 antibody tested by IHC with human Colon (ARP38224)
What is the species homology for "SMARCE1 Antibody - N-terminal region (ARP38224_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".
How long will it take to receive "SMARCE1 Antibody - N-terminal region (ARP38224_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
What buffer format is "SMARCE1 Antibody - N-terminal region (ARP38224_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "SMARCE1 Antibody - N-terminal region (ARP38224_P050)"?
This target may also be called "BAF57" in publications.
What is the shipping cost for "SMARCE1 Antibody - N-terminal region (ARP38224_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "SMARCE1 Antibody - N-terminal region (ARP38224_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "SMARCE1 Antibody - N-terminal region (ARP38224_P050)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "47kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "SMARCE1 Antibody - N-terminal region (ARP38224_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "SMARCE1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "SMARCE1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "SMARCE1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "SMARCE1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "SMARCE1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "SMARCE1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
