| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Replacement Item | This antibody may replace item sc-133642 from Santa Cruz Biotechnology. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GSTM3 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 85%; Dog: 77%; Horse: 85%; Human: 100%; Mouse: 79%; Pig: 92%; Rabbit: 86%; Rat: 79% |
| Complete computational species homology data | Anti-GSTM3 (ARP53561_P050) |
| Peptide Sequence | Synthetic peptide located within the following region: EEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMF |
| Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
| Blocking Peptide | For anti-GSTM3 (ARP53561_P050) antibody is Catalog # AAP53561 (Previous Catalog # AAPS32801) |
| Datasheets/Manuals | Printable datasheet for anti-GSTM3 (ARP53561_P050) antibody |
| Target Reference | Ikeda,S., (2008) Am. J. Gastroenterol. 103 (6), 1476-1487 |
| Gene Symbol | GSTM3 |
|---|---|
| Official Gene Full Name | Glutathione S-transferase mu 3 (brain) |
| Alias Symbols | GST5, GSTB, GSTM3-3, GTM3, MGC3310, MGC3704 |
| NCBI Gene Id | 2947 |
| Protein Name | Glutathione S-transferase Mu 3 |
| Description of Target | Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. GSTM3 is a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual"s susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Mutations of this class mu gene have been linked with a slight increase in a number of cancers, likely due to exposure with environmental toxins.Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual"s susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Mutations of this class mu gene have been linked with a slight increase in a number of cancers, likely due to exposure with environmental toxins. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Swissprot Id | P21266 |
| Protein Accession # | NP_000840 |
| Nucleotide Accession # | NM_000849 |
| Protein Size (# AA) | 225 |
| Molecular Weight | 26kDa |
| Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express GSTM3.  |
| RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express GSTM3.  |
| Protein Interactions | GSTM5; GSTM4; GSTM3; GSTM1; UBC; ESR1; BAG3; SUMO2; SH3GL2; UCHL5; GSTM2; MPG; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
- Reviewed Data:
- Product Protocols: GSTM3 antibody tested with Human Hepg2 Cells (ARP53561_P050)
What is the species homology for "GSTM3 Antibody - middle region (ARP53561_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat".
How long will it take to receive "GSTM3 Antibody - middle region (ARP53561_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
What buffer format is "GSTM3 Antibody - middle region (ARP53561_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "GSTM3 Antibody - middle region (ARP53561_P050)"?
This target may also be called "GST5, GSTB, GSTM3-3, GTM3, MGC3310, MGC3704" in publications.
What is the shipping cost for "GSTM3 Antibody - middle region (ARP53561_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "GSTM3 Antibody - middle region (ARP53561_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "GSTM3 Antibody - middle region (ARP53561_P050)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "26kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "GSTM3 Antibody - middle region (ARP53561_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "GSTM3"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "GSTM3"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "GSTM3"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "GSTM3"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "GSTM3"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "GSTM3"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
