
Tested Species Reactivity | Mouse |
---|---|
Predicted Species Reactivity | Mouse |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse PDPK1 |
Purification | Affinity purified |
Peptide Sequence | Synthetic peptide located within the following region: NPLQQHPAQLPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAI |
Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
Blocking Peptide | For anti-PDPK1 (ARP89942_P050) antibody is Catalog # AAP89942 |
Datasheets/Manuals | Printable datasheet for anti-PDPK1 (ARP89942_P050) antibody |
Gene Symbol | PDPK1 |
---|---|
Official Gene Full Name | 3-phosphoinositide dependent protein kinase 1 |
Alias Symbols | Pdk1 |
NCBI Gene Id | 18607 |
Protein Name | Pdk1 |
Description of Target | Serine/threonine kinase which acts as a master kinase, phosphorylating and activating a subgroup of the AGC family of protein kinases. Its targets include: protein kinase B (PKB/AKT1, PKB/AKT2, PKB/AKT3), p70 ribosomal protein S6 kinase (RPS6KB1), p90 ribosomal protein S6 kinase (RPS6KA1, RPS6KA2 and RPS6KA3), cyclic AMP-dependent protein kinase (PRKACA), protein kinase C (PRKCD and PRKCZ), serum and glucocorticoid-inducible kinase (SGK1, SGK2 and SGK3), p21-activated kinase-1 (PAK1), protein kinase PKN (PKN1 and PKN2). Plays a central role in the transduction of signals from insulin by providing the activating phosphorylation to PKB/AKT1, thus propagating the signal to downstream targets controlling cell proliferation and survival, as well as glucose and amino acid uptake and storage. Negatively regulates the TGF-beta-induced signaling by: modulating the association of SMAD3 and SMAD7 with TGF-beta receptor, phosphorylating SMAD2, SMAD3, SMAD4 and SMAD7, preventing the nuclear translocation of SMAD3 and SMAD4 and the translocation of SMAD7 from the nucleus to the cytoplasm in response to TGF-beta. Activates PPARG transcriptional activity and promotes adipocyte differentiation. Activates the NF-kappa-B pathway via phosphorylation of IKKB. The tyrosine phosphorylated form is crucial for the regulation of focal adhesions by angiotensin II. Controls proliferation, survival, and growth of developing pancreatic cells. Participates in the regulation of Ca2+ entry and Ca2+-activated K+ channels of mast cells. Essential for the motility of vascular endothelial cells (ECs) and is involved in the regulation of their chemotaxis. Plays a critical role in cardiac homeostasis by serving as a dual effector for cell survival and beta-adrenergic response. Plays an important role during thymocyte development by regulating the expression of key nutrient receptors on the surface of pre-T cells and mediating Notch-induced cell growth and proliferative responses. Provides negative feedback inhibition to toll-like receptor-mediated NF-kappa-B activation in macrophages. |
Swissprot Id | Q9Z2A0 |
Protein Accession # | NP_035192.2 |
Nucleotide Accession # | NM_011062.4 |
Protein Size (# AA) | 559 |
Molecular Weight | 61 kDa |
Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express PDPK1. ![]() |
RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express PDPK1. ![]() |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
What is the species homology for "PDPK1 Antibody - N-terminal region (ARP89942_P050)"?
The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Mouse".
How long will it take to receive "PDPK1 Antibody - N-terminal region (ARP89942_P050)"?
This item is available "Domestic: within 24 hours delivery | International: 3-5 days".
What buffer format is "PDPK1 Antibody - N-terminal region (ARP89942_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "PDPK1 Antibody - N-terminal region (ARP89942_P050)"?
This target may also be called "Pdk1" in publications.
What is the shipping cost for "PDPK1 Antibody - N-terminal region (ARP89942_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "PDPK1 Antibody - N-terminal region (ARP89942_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "PDPK1 Antibody - N-terminal region (ARP89942_P050)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "61 kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "PDPK1 Antibody - N-terminal region (ARP89942_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "PDPK1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "PDPK1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "PDPK1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "PDPK1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "PDPK1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "PDPK1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.