
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Guinea Pig, Human, Mouse |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IF, WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Replacement Item | This antibody may replace item sc-1067 from Santa Cruz Biotechnology. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TNFRSF1A |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Guinea Pig: 84%; Human: 100%; Mouse: 92% |
Complete computational species homology data | Anti-TNFRSF1A (AVARP00034_P050) |
Peptide Sequence | Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI |
Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
Blocking Peptide | For anti-TNFRSF1A (AVARP00034_P050) antibody is Catalog # AAP30521 (Previous Catalog # AAPP01157) |
Datasheets/Manuals | Printable datasheet for anti-TNFRSF1A (AVARP00034_P050) antibody |
Sample Type Confirmation | TNFRSF1A is supported by BioGPS gene expression data to be expressed in DU145 |
Target Reference | Gattorno,M., (2008) Arthritis Rheum. 58 (6), 1823-1832 |
Gene Symbol | TNFRSF1A |
---|---|
Official Gene Full Name | Tumor necrosis factor receptor superfamily, member 1A |
Alias Symbols | CD120a, FPF, MGC19588, TBP1, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR55, TNFR60, p55, p55-R, p60 |
NCBI Gene Id | 7132 |
Protein Name | Tumor necrosis factor receptor superfamily member 1A |
Description of Target | TNFRSF1A is the receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. TNFRSF1A contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is one of the major receptors for the tumor necrosis factor-alpha. This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the autosomal dominant periodic fever syndrome. The impaired receptor clearance is thought to be a mechanism of the disease. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Swissprot Id | P19438 |
Protein Accession # | NP_001056 |
Nucleotide Accession # | NM_001065 |
Protein Size (# AA) | 455 |
Molecular Weight | 48kDa |
Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express TNFRSF1A. ![]() |
RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express TNFRSF1A. ![]() |
Protein Interactions | RIPK1; UBC; UCHL1; TNF; STAMBP; RNF8; TRAF2; TRADD; ADAM17; LTA; SRC; SHARPIN; KHDRBS1; IKBKB; CHUK; MAP3K7; PPP1CA; PIK3R1; JAK2; ATF6; PRDX3; OPTN; FADD; TNFRSF1A; SGTA; PRKCD; PRKCB; HRG; GYS2; BIRC2; UBQLN1; MAGEH1; SOS1; MYOC; GRB2; DAXX; BIRC3; Traf |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
- Reviewed Data:
- Product Review: TNFRSF1A antibody - N-terminal region (AVARP00034_P050) tested with human lymphocytes in Immunofluorescence
- Product Protocols: TNFRSF1A antibody tested with Human Du145 Cells (AVARP00034_P050)
What is the species homology for "TNFRSF1A Antibody - N-terminal region (AVARP00034_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Guinea Pig, Human, Mouse".
How long will it take to receive "TNFRSF1A Antibody - N-terminal region (AVARP00034_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
What buffer format is "TNFRSF1A Antibody - N-terminal region (AVARP00034_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "TNFRSF1A Antibody - N-terminal region (AVARP00034_P050)"?
This target may also be called "CD120a, FPF, MGC19588, TBP1, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR55, TNFR60, p55, p55-R, p60" in publications.
What is the shipping cost for "TNFRSF1A Antibody - N-terminal region (AVARP00034_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "TNFRSF1A Antibody - N-terminal region (AVARP00034_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "TNFRSF1A Antibody - N-terminal region (AVARP00034_P050)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "48kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "TNFRSF1A Antibody - N-terminal region (AVARP00034_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "TNFRSF1A"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "TNFRSF1A"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "TNFRSF1A"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "TNFRSF1A"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "TNFRSF1A"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "TNFRSF1A"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.