| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB, IP |
| Additional Information | IHC Information: HepG2 cell lysate. Antibody concentration: 0.25 ug/ml. Gel concentration: 12%. |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Replacement Item | This antibody may replace item sc-102083 from Santa Cruz Biotechnology. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RHOT1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Complete computational species homology data | Anti-RHOT1 (ARP44817_P050) |
| Peptide Sequence | Synthetic peptide located within the following region: MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER |
| Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
| Blocking Peptide | For anti-RHOT1 (ARP44817_P050) antibody is Catalog # AAP44817 (Previous Catalog # AAPP12293) |
| Datasheets/Manuals | Printable datasheet for anti-RHOT1 (ARP44817_P050) antibody |
| Target Reference | Brandenberger,R., (2004) Nat. Biotechnol. 22 (6), 707-716 |
| Gene Symbol | RHOT1 |
|---|---|
| Official Gene Full Name | Ras homolog family member T1 |
| Alias Symbols | ARHT1, FLJ11040, FLJ12633, MIRO-1, MIRO1 |
| NCBI Gene Id | 55288 |
| Protein Name | Mitochondrial Rho GTPase 1 |
| Description of Target | Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution. |
| Swissprot Id | Q8IXI2 |
| Protein Accession # | NP_060777 |
| Nucleotide Accession # | NM_018307 |
| Protein Size (# AA) | 618 |
| Molecular Weight | 71kDa |
| Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express RHOT1.  |
| RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express RHOT1.  |
| Protein Interactions | PCSK9; ERLIN2; PARK2; ILK; UBC; CFTR; PINK1; UBD; IRAK1; AMFR; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
- Reviewed Data:
- Product Protocols: RHOT1 antibody tested by IHC with human muscle (ARP44817)
- Product Review: RHOT1 antibody - N-terminal region (ARP44817_P050) in mouse brain and human neuroblastoma using Western Blot
- Product Protocols: RHOT1 antibody tested with Human A549Cells (ARP44817_P050)
What is the species homology for "RHOT1 Antibody - N-terminal region (ARP44817_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".
How long will it take to receive "RHOT1 Antibody - N-terminal region (ARP44817_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
What buffer format is "RHOT1 Antibody - N-terminal region (ARP44817_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "RHOT1 Antibody - N-terminal region (ARP44817_P050)"?
This target may also be called "ARHT1, FLJ11040, FLJ12633, MIRO-1, MIRO1" in publications.
What is the shipping cost for "RHOT1 Antibody - N-terminal region (ARP44817_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "RHOT1 Antibody - N-terminal region (ARP44817_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "RHOT1 Antibody - N-terminal region (ARP44817_P050)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "71kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "RHOT1 Antibody - N-terminal region (ARP44817_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "RHOT1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "RHOT1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "RHOT1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "RHOT1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "RHOT1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "RHOT1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
