| Tested Species Reactivity | Human, Mouse |
|---|---|
| Predicted Species Reactivity | Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Replacement Item | This antibody may replace item sc-116903 from Santa Cruz Biotechnology. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ARRB2 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Complete computational species homology data | Anti-ARRB2 (ARP48007_P050) |
| Peptide Sequence | Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL |
| Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
| Blocking Peptide | For anti-ARRB2 (ARP48007_P050) antibody is Catalog # AAP48007 (Previous Catalog # AAPS20510) |
| Datasheets/Manuals | Printable datasheet for anti-ARRB2 (ARP48007_P050) antibody |
| Sample Type Confirmation | ARRB2 is supported by BioGPS gene expression data to be expressed in HepG2 |
| Target Reference | Luan,B., (2005) EMBO J. 24 (24), 4237-4246 |
| Gene Symbol | ARRB2 |
|---|---|
| Official Gene Full Name | Arrestin, beta 2 |
| Alias Symbols | ARB2, ARR2, DKFZp686L0365, BARR2 |
| NCBI Gene Id | 409 |
| Protein Name | Beta-arrestin-2 |
| Description of Target | Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. ARRB2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors.Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. |
| Swissprot Id | P32121 |
| Protein Accession # | NP_945355 |
| Nucleotide Accession # | NM_199004 |
| Protein Size (# AA) | 409 |
| Molecular Weight | 46kDa |
| Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express ARRB2.  |
| RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express ARRB2.  |
| Protein Interactions | UBC; SRC; MAPK9; INSR; AKT1; USP33; ADRB2; TBXA2R; CYTH1; PTGDS; BAI1; LIMK1; CFL1; CSK; AGTR1; MAP2K4; MAPK10; MAP3K5; GCG; NFKBIA; MDM2; IGF1R; CLTC; ADRB1; HIPK3; EDNRA; gag-pol; ARRDC3; ARRDC4; SIRT1; PDE4D; Mlnr; Trhr; C5AR1; SLC9A5; AP2M1; HCRTR1; F |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
- Reviewed Data:
- Product Protocols: ARRB2 antibody tested by IHC with human skin (ARP48007)
- Product Review: ARRB2 antibody - middle region (ARP48007_P050) in mouse left ventricle heart lysate using Western Blot
What is the species homology for "ARRB2 Antibody - middle region (ARP48007_P050)"?
The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish".
How long will it take to receive "ARRB2 Antibody - middle region (ARP48007_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
What buffer format is "ARRB2 Antibody - middle region (ARP48007_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "ARRB2 Antibody - middle region (ARP48007_P050)"?
This target may also be called "ARB2, ARR2, DKFZp686L0365, BARR2" in publications.
What is the shipping cost for "ARRB2 Antibody - middle region (ARP48007_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "ARRB2 Antibody - middle region (ARP48007_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "ARRB2 Antibody - middle region (ARP48007_P050)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "46kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "ARRB2 Antibody - middle region (ARP48007_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "ARRB2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "ARRB2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "ARRB2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "ARRB2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "ARRB2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "ARRB2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
