
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB, IHC |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Replacement Item | This antibody may replace item sc-100560 from Santa Cruz Biotechnology. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MFN2 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Complete computational species homology data | Anti-MFN2 (ARP42420_P050) |
Peptide Sequence | Synthetic peptide located within the following region: LEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR |
Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
Blocking Peptide | For anti-MFN2 (ARP42420_P050) antibody is Catalog # AAP42420 (Previous Catalog # AAPP11559) |
Datasheets/Manuals | Printable datasheet for anti-MFN2 (ARP42420_P050) antibody |
Target Reference | Chung,K.W., (2008) Neurology 70 (21), 2010-2011 |
Publications | Hepatitis C virus NS5A protein cooperates with phosphatidylinositol 4-kinase IIIα to induce mitochondrial fragmentation. Sci Rep. 6: 23464 (2016). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 27010100 |
Gene Symbol | MFN2 |
---|---|
Official Gene Full Name | Mitofusin 2 |
Alias Symbols | CMT2A, CMT2A2, CPRP1, HSG, KIAA0214, MARF |
NCBI Gene Id | 9927 |
Protein Name | Mitofusin-2 |
Description of Target | MFN2 is a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. It is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke.This gene encodes a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. This protein is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke. Two transcript variants encoding the same protein have been identified. |
Swissprot Id | O95140 |
Protein Accession # | NP_055689 |
Nucleotide Accession # | NM_014874 |
Protein Size (# AA) | 757 |
Molecular Weight | 86kDa |
Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express MFN2. ![]() |
RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express MFN2. ![]() |
Protein Interactions | UBC; MARCH5; PARK2; UBE2N; MFN2; TER94; MAVS; vpr; HUWE1; MAPK9; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
- Reviewed Data:
- Product Protocols: MFN2 antibody tested with Human 293T Cells (ARP42420_P050)
- Product Protocol: MFN2 Antibody (ARP42420_P050) in Human Heart Tissue using Immunohistochemistry
- Product Protocol: MFN2 Antibody (ARP42420_P050) in Human Heart Tissue using Immunohistochemistry
What is the species homology for "MFN2 Antibody - C-terminal region (ARP42420_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".
How long will it take to receive "MFN2 Antibody - C-terminal region (ARP42420_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
What buffer format is "MFN2 Antibody - C-terminal region (ARP42420_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "MFN2 Antibody - C-terminal region (ARP42420_P050)"?
This target may also be called "CMT2A, CMT2A2, CPRP1, HSG, KIAA0214, MARF" in publications.
What is the shipping cost for "MFN2 Antibody - C-terminal region (ARP42420_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "MFN2 Antibody - C-terminal region (ARP42420_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "MFN2 Antibody - C-terminal region (ARP42420_P050)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "86kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "MFN2 Antibody - C-terminal region (ARP42420_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "MFN2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "MFN2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "MFN2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "MFN2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "MFN2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "MFN2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.