
Predicted Species Reactivity | Mouse |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse CLDN11 |
Purification | Affinity purified |
Peptide Sequence | Synthetic peptide located within the following region: LLLTVLPCIRMGHEPGVAKYRRAQLAGVLLILLALCAIVATIWFPVCAHR |
Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
Blocking Peptide | For anti-CLDN11 (ARP90621_P050) antibody is Catalog # AAP90621 |
Datasheets/Manuals | Printable datasheet for anti-CLDN11 (ARP90621_P050) antibody |
Gene Symbol | CLDN11 |
---|---|
Official Gene Full Name | claudin 11 |
Alias Symbols | Osp, Otm, Claudin11, Claudin-11 |
NCBI Gene Id | 18417 |
Protein Name | claudin-11 |
Description of Target | This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. The protein encoded by this gene is a major component of CNS (central nervous system) myelin and plays an important role in regulating proliferation and migration of oligodendrocytes. The basal cell tight junctions in stria vascularis are primarily composed of this protein, and the gene-null mice suffer severe deafness. This protein is also an obligatory protein for tight junction formation and barrier integrity in the testis and the gene deficiency results in loss of the Sertoli cell epithelial phenotype in the testis. |
Swissprot Id | Q60771 |
Protein Accession # | NP_032796.1 |
Nucleotide Accession # | NM_008770.3 |
Protein Size (# AA) | 207 |
Molecular Weight | 22 kDa |
Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express CLDN11. ![]() |
RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express CLDN11. ![]() |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
What is the species homology for "CLDN11 Antibody - middle region (ARP90621_P050)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Mouse".
How long will it take to receive "CLDN11 Antibody - middle region (ARP90621_P050)"?
This item is available "Domestic: within 24 hours delivery | International: 3-5 days".
What buffer format is "CLDN11 Antibody - middle region (ARP90621_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "CLDN11 Antibody - middle region (ARP90621_P050)"?
This target may also be called "Osp, Otm, Claudin11, Claudin-11" in publications.
What is the shipping cost for "CLDN11 Antibody - middle region (ARP90621_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "CLDN11 Antibody - middle region (ARP90621_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "CLDN11 Antibody - middle region (ARP90621_P050)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "22 kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "CLDN11 Antibody - middle region (ARP90621_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "CLDN11"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "CLDN11"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "CLDN11"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "CLDN11"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "CLDN11"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "CLDN11"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.