| Predicted Species Reactivity | Mouse |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse EIF4G2 |
| Purification | Affinity purified |
| Peptide Sequence | Synthetic peptide located within the following region: GQNAQKWIPARSTRRDDNSAANNSANEKERHDAIFRKVRGILNKLTPEKF |
| Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
| Blocking Peptide | For anti-EIF4G2 (ARP90937_P050) antibody is Catalog # AAP90937 |
| Datasheets/Manuals | Printable datasheet for anti-EIF4G2 (ARP90937_P050) antibody |
| Gene Symbol | EIF4G2 |
|---|---|
| Official Gene Full Name | eukaryotic translation initiation factor 4, gamma 2 |
| Alias Symbols | p97, Nat1, DAP-5, Natm1, E130105L11Rik |
| NCBI Gene Id | 13690 |
| Protein Name | eukaryotic translation initiation factor 4 gamma 2 |
| Description of Target | Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G, that contains the binding sites for eIF4A and eIF3; eIF4G in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. Transgene expression of the apolipoprotein B mRNA-editing enzyme (APOBEC-1) causes extensive editing of this mRNA, which could contribute to the potent oncogenesis induced by overexpression of APOBEC-1. In vitro and in vivo studies in human indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. This also appears to be true for mouse. Two alternatively spliced transcript variants that encode different isoforms have been found for this gene. |
| Swissprot Id | Q62448 |
| Protein Accession # | NP_001035221.1 |
| Nucleotide Accession # | NM_001040131.2 |
| Protein Size (# AA) | 906 |
| Molecular Weight | 99 kDa |
| Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express EIF4G2.  |
| RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express EIF4G2.  |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
What is the species homology for "EIF4G2 Antibody - N-terminal region (ARP90937_P050)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Mouse".
How long will it take to receive "EIF4G2 Antibody - N-terminal region (ARP90937_P050)"?
This item is available "Domestic: within 24 hours delivery | International: 3-5 days".
What buffer format is "EIF4G2 Antibody - N-terminal region (ARP90937_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "EIF4G2 Antibody - N-terminal region (ARP90937_P050)"?
This target may also be called "p97, Nat1, DAP-5, Natm1, E130105L11Rik" in publications.
What is the shipping cost for "EIF4G2 Antibody - N-terminal region (ARP90937_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "EIF4G2 Antibody - N-terminal region (ARP90937_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "EIF4G2 Antibody - N-terminal region (ARP90937_P050)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "99 kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "EIF4G2 Antibody - N-terminal region (ARP90937_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "EIF4G2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "EIF4G2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "EIF4G2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "EIF4G2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "EIF4G2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "EIF4G2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
