
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HNRPDL |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93% |
Complete computational species homology data | Anti-HNRPDL (ARP40585_T100) |
Peptide Sequence | Synthetic peptide located within the following region: TMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYL |
Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
Blocking Peptide | For anti-HNRNPDL (ARP40585_T100) antibody is Catalog # AAP40585 (Previous Catalog # AAPP22761) |
Datasheets/Manuals | Printable datasheet for anti-HNRNPDL (ARP40585_T100) antibody |
Sample Type Confirmation | HNRNPDL is strongly supported by BioGPS gene expression data to be expressed in Daudi |
Target Reference | Mural,R.J., (2005) Direct Submission |
Gene Symbol | HNRNPDL |
---|---|
Official Gene Full Name | heterogeneous nuclear ribonucleoprotein D like |
Alias Symbols | HNRNP, JKTBP, HNRPDL, JKTBP2, LGMD1G, laAUF1 |
NCBI Gene Id | 9987 |
Protein Name | heterogeneous nuclear ribonucleoprotein D-like |
Description of Target | This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two RRM domains that bind to RNAs. Three alternatively spliced transcript variants have been described for this gene. One of the variants is probably not translated because the transcript is a candidate for nonsense-mediated mRNA decay. The protein isoforms encoded by this gene are similar to its family member HNRPD. |
Swissprot Id | O14979 |
Protein Accession # | EAX05890 |
Nucleotide Accession # | NM_001207000 |
Protein Size (# AA) | 363 |
Molecular Weight | 40kDa |
Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express HNRNPDL. ![]() |
RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express HNRNPDL. ![]() |
Protein Interactions | SPRTN; SUMO2; SUMO3; UBC; RPA3; RPA2; RPA1; ERG; EED; RNF2; rev; PARK2; FBXO6; TARDBP; HMGA1; ITGA4; IL7R; IFIT3; IFIT2; FN1; CSNK2A1; BARD1; EEF2; EEF1A1; DDX3X; ATP6V1B1; HNRNPA3; WIPF2; RMDN3; MRPS16; UBE2S; LSM14A; RPL36; U2AF2; HNRNPUL1; HNRNPA0; HNR |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
- Reviewed Data:
- Product Protocols: HNRPDL antibody tested with Human Daudi Cells (ARP40585_T100)
- Product Protocols: HNRPDL antibody tested by IHC with human heart (ARP40585)
- Product Protocols: HNRPDL antibody tested by IHC with human muscle (ARP40585)
What is the species homology for "HNRNPDL Antibody - middle region (ARP40585_T100)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish".
How long will it take to receive "HNRNPDL Antibody - middle region (ARP40585_T100)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
What buffer format is "HNRNPDL Antibody - middle region (ARP40585_T100)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "HNRNPDL Antibody - middle region (ARP40585_T100)"?
This target may also be called "HNRNP, JKTBP, HNRPDL, JKTBP2, LGMD1G, laAUF1" in publications.
What is the shipping cost for "HNRNPDL Antibody - middle region (ARP40585_T100)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "HNRNPDL Antibody - middle region (ARP40585_T100)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "HNRNPDL Antibody - middle region (ARP40585_T100)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "40kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "HNRNPDL Antibody - middle region (ARP40585_T100)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "HNRNPDL"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "HNRNPDL"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "HNRNPDL"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "HNRNPDL"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "HNRNPDL"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "HNRNPDL"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.