| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human U2AF2 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 100% |
| Complete computational species homology data | Anti-U2AF2 (ARP40285_P050) |
| Peptide Sequence | Synthetic peptide located within the following region: TEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGV |
| Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
| Blocking Peptide | For anti-U2AF2 (ARP40285_P050) antibody is Catalog # AAP40285 |
| Datasheets/Manuals | Printable datasheet for anti-U2AF2 (ARP40285_P050) antibody |
| Sample Type Confirmation | There is BioGPS gene expression data showing that U2AF2 is expressed in HepG2 |
| Gene Symbol | U2AF2 |
|---|---|
| Official Gene Full Name | U2 small nuclear RNA auxiliary factor 2 |
| Alias Symbols | U2AF65 |
| NCBI Gene Id | 11338 |
| Protein Name | U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2, isoform CRA_a EMBL EDL31286.1 |
| Description of Target | U2 auxiliary factor (U2AF), comprised of a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. U2AF2 is the U2AF large subunit which contains a sequence-specific RNA-binding region with 3 RNA recognition motifs and an Arg/Ser-rich domain necessary for splicing. The large subunit binds to the polypyrimidine tract of introns early during spliceosome assembly. |
| Swissprot Id | Q80XR5 |
| Protein Accession # | NP_001012496 |
| Nucleotide Accession # | NM_001012478 |
| Protein Size (# AA) | 471 |
| Molecular Weight | 53kDa |
| Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express U2AF2.  |
| RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express U2AF2.  |
| Protein Interactions | THAP1; PUF60; U2AF1; SNRPA; AES; DACH1; SUMO3; UBC; SUZ12; EED; TERF1; EZH2; RNF2; PRPF40A; TCERG1; APBB1; PIN1; SH3RF2; SRPK2; SRPK1; SF1; SRSF1; RBM39; QKI; SCAF11; PRPF3; RBM10; RBM4; SMAD5; IL7R; HNRNPK; HNRNPD; HLA-DMA; SUGP1; CCAR1; SAP30BP; RBFOX2; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
- Reviewed Data:
- Product Protocols: U2AF2 antibody tested with Human Hepg2 Cells (ARP40285_P050)
What is the species homology for "U2AF2 Antibody - C-terminal region (ARP40285_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish".
How long will it take to receive "U2AF2 Antibody - C-terminal region (ARP40285_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
What buffer format is "U2AF2 Antibody - C-terminal region (ARP40285_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "U2AF2 Antibody - C-terminal region (ARP40285_P050)"?
This target may also be called "U2AF65" in publications.
What is the shipping cost for "U2AF2 Antibody - C-terminal region (ARP40285_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "U2AF2 Antibody - C-terminal region (ARP40285_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "U2AF2 Antibody - C-terminal region (ARP40285_P050)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "53kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "U2AF2 Antibody - C-terminal region (ARP40285_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "U2AF2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "U2AF2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "U2AF2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "U2AF2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "U2AF2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "U2AF2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
