
Tested Species Reactivity | Human, Mouse |
---|---|
Predicted Species Reactivity | Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Replacement Item | This antibody may replace item sc-126032 from Santa Cruz Biotechnology. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SOX9 |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
Complete computational species homology data | Anti-SOX9 (P100797_T100) |
Peptide Sequence | Synthetic peptide located within the following region: PCPSGSGSDTENTRPQENTFPKGEPDLKKESEEDKFPVCIREAVSQVLKG |
Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
Blocking Peptide | For anti-SOX9 (P100797_T100) antibody is Catalog # AAP31138 (Previous Catalog # AAPP01877) |
Datasheets/Manuals | Printable datasheet for anti-SOX9 (P100797_T100) antibody |
Sample Type Confirmation | SOX9 is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
Target Reference | Furumatsu,T., et al., (2005) J. Biol. Chem. 280 (42), 35203-35208 |
Publications | Ferrand, N. et al. Loss of WISP2/CCN5 in estrogen-dependent MCF7 human breast cancer cells promotes a stem-like cell phenotype. PLoS One 9, e87878 (2014). WB, Human, Mouse 24498388 |
Gene Symbol | SOX9 |
---|---|
Official Gene Full Name | SRY (sex determining region Y)-box 9 |
Alias Symbols | CMD1, SRA1, CMPD1 |
NCBI Gene Id | 6662 |
Protein Name | Transcription factor SOX-9 |
Description of Target | SOX9 recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. |
Swissprot Id | P48436 |
Protein Accession # | NP_000337 |
Nucleotide Accession # | NM_000346 |
Protein Size (# AA) | 509 |
Molecular Weight | 56kDa |
Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express SOX9. ![]() |
RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express SOX9. ![]() |
Protein Interactions | ZBTB7A; SCX; HERC1; UBC; SOX9; ATP6V1H; ctnnb1-a; RUNX2; SMAD3; SMAD2; EP300; CREB3L4; SPEN; KPNB1; TRAF2; CREBBP; MED12; NR5A1; MAF; HSPA1A; CREB1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
- Reviewed Data:
- Product Protocols: SOX9 antibody tested with Human Hepg2 Cells (P100797_T100)
What is the species homology for "SOX9 Antibody - N-terminal region (P100797_T100)"?
The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish".
How long will it take to receive "SOX9 Antibody - N-terminal region (P100797_T100)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
What buffer format is "SOX9 Antibody - N-terminal region (P100797_T100)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "SOX9 Antibody - N-terminal region (P100797_T100)"?
This target may also be called "CMD1, SRA1, CMPD1" in publications.
What is the shipping cost for "SOX9 Antibody - N-terminal region (P100797_T100)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "SOX9 Antibody - N-terminal region (P100797_T100)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "SOX9 Antibody - N-terminal region (P100797_T100)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "56kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "SOX9 Antibody - N-terminal region (P100797_T100)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "SOX9"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "SOX9"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "SOX9"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "SOX9"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "SOX9"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "SOX9"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.