Predicted Species Reactivity | Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat |
---|---|
Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | HRP: Horseradish Peroxidase |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence YCGLGGRGQPKDEVDWCCHAHDCCYQELFDQGCHPYVDHYDHTIENNTEI |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 86%; Dog: 79%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 100% |
Complete computational species homology data | Anti-PLA2G2F (ARP67742_P050) |
Peptide Sequence | Synthetic peptide located within the following region: YCGLGGRGQPKDEVDWCCHAHDCCYQELFDQGCHPYVDHYDHTIENNTEI |
Concentration | 0.5 mg/ml |
Blocking Peptide | Available upon request |
Datasheets/Manuals | Printable datasheet for anti-PLA2G2F (ARP67742_P050-HRP) antibody |
Gene Symbol | PLA2G2F |
---|---|
Official Gene Full Name | phospholipase A2, group IIF |
NCBI Gene Id | 64600 |
Protein Name | Group IIF secretory phospholipase A2 |
Swissprot Id | Q9BZM2 |
Protein Accession # | NP_073730 |
Nucleotide Accession # | NM_022819 |
Protein Size (# AA) | 168 |
Molecular Weight | 19 kDa |
Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express PLA2G2F. ![]() |
RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express PLA2G2F. ![]() |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
What is the species homology for "PLA2G2F Antibody : HRP (ARP67742_P050-HRP)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".
How long will it take to receive "PLA2G2F Antibody : HRP (ARP67742_P050-HRP)"?
This item is available "Domestic: within 1 week delivery | International: 1 week".
What buffer format is "PLA2G2F Antibody : HRP (ARP67742_P050-HRP)" provided in?
This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "PLA2G2F Antibody : HRP (ARP67742_P050-HRP)"?
This target may also be called "" in publications.
What is the shipping cost for "PLA2G2F Antibody : HRP (ARP67742_P050-HRP)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "PLA2G2F Antibody : HRP (ARP67742_P050-HRP)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "PLA2G2F Antibody : HRP (ARP67742_P050-HRP)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "19 kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "PLA2G2F Antibody : HRP (ARP67742_P050-HRP)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "PLA2G2F"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "PLA2G2F"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "PLA2G2F"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "PLA2G2F"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "PLA2G2F"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "PLA2G2F"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.