| Predicted Species Reactivity | Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence GLSKESVDQEKKAYSFCGTVEYMAPEVVNRRGHSQSADWWSYGVLMFEML |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Complete computational species homology data | Anti-RPS6KA6 (ARP65702_P050) |
| Peptide Sequence | Synthetic peptide located within the following region: GLSKESVDQEKKAYSFCGTVEYMAPEVVNRRGHSQSADWWSYGVLMFEML |
| Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
| Blocking Peptide | Available upon request |
| Datasheets/Manuals | Printable datasheet for anti-RPS6KA6 (ARP65702_P050) antibody |
| Gene Symbol | RPS6KA6 |
|---|---|
| Official Gene Full Name | ribosomal protein S6 kinase, 90kDa, polypeptide 6 |
| Alias Symbols | RSK4, PP90RSK4, |
| NCBI Gene Id | 27330 |
| Protein Name | Ribosomal protein S6 kinase alpha-6 |
| Description of Target | This gene encodes a member of ribosomal S6 kinase family, serine-threonine protein kinases which are regulated by growth factors. The encoded protein may be distinct from other members of this family, however, as studies suggest it is not growth factor dependent and may not participate in the same signaling pathways. |
| Swissprot Id | Q9UK32 |
| Protein Accession # | NP_055311 |
| Nucleotide Accession # | NM_014496 |
| Protein Size (# AA) | 745 |
| Molecular Weight | 84 kDa |
| Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express RPS6KA6. |
| RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express RPS6KA6. |
| Protein Interactions | UBC; HSP90AA1; CDC37; UBAC1; PQBP1; SLC9A1; NFYA; MBP; APP; UBE2I; SYNE4; ZNF746; FBN3; MICAL1; SPTBN4; UFM1; SAP30BP; DNAJC13; C14orf1; ADIRF; CEBPZ; MED24; DHX34; LMO4; FZD5; ZNF227; CLEC3B; RXRA; RPLP1; MASP1; MAPK3; MPP1; RBPJ; DNMT1; CENPB; NR4A1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
What is the species homology for "RPS6KA6 Antibody (ARP65702_P050)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish".
How long will it take to receive "RPS6KA6 Antibody (ARP65702_P050)"?
This item is available "Domestic: within 1 week delivery | International: 1 week".
What buffer format is "RPS6KA6 Antibody (ARP65702_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "RPS6KA6 Antibody (ARP65702_P050)"?
This target may also be called "RSK4, PP90RSK4, " in publications.
What is the shipping cost for "RPS6KA6 Antibody (ARP65702_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "RPS6KA6 Antibody (ARP65702_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "RPS6KA6 Antibody (ARP65702_P050)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "84 kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "RPS6KA6 Antibody (ARP65702_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "RPS6KA6"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "RPS6KA6"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "RPS6KA6"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "RPS6KA6"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "RPS6KA6"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "RPS6KA6"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

